TRIM72 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16751
Additional Names:: MG53|TRIM72
Application:: ELISA, WB
Molecular Weight:: 53kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DAGVALRRELSSLNSYLEQLRQMEKVLEEVADKPQTEFLMKFCLVTSRLQKILSESPPPARLDIQLPVISDDFKFQVWKKMFRALMPALEELTFDPSSAHP
Uniprot:: Q1XH17
Synonyms:: BC067209;MG53;mitsugumin 53;mitsugumin-53;tripartite motif containing 72, E3 ubiquitin protein ligase;tripartite motif-containing protein 72
Extra Details:: Enables identical protein binding activity. Predicted to be involved in several processes, including cellular protein metabolic process; plasma membrane repair; and protein homooligomerization. Predicted to act upstream of or within negative regulation of insulin receptor signaling pathway; negative regulation of insulin-like growth factor receptor signaling pathway; and negative regulation of myotube differentiation. Predicted to be located in cytoplasmic vesicle membrane. Predicted to be active in cytoplasm and sarcolemma.