A16748
ADARB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16748
- Additional Names:
- ADAR2|ADARB1|DRABA2|DRADA2|NEDHYMS|RED1
- Application:
- ELISA, WB
- Molecular Weight:
- 81kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- FETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCING
- Uniprot:
- P78563
- Synonyms:
- ADAR2;adenosine deaminase, RNA-specific, B1 (homolog of rat RED1);double-stranded RNA-specific editase 1;DRABA2;DRADA2;dsRNA adenosine deaminase;dsRNA adenosine deaminase DRADA2;NEDHYMS;RED1;RNA editing deaminase 1;RNA-editing deaminase 1;RNA-editing enzyme 1
- Extra Details:
- This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.
- Shipping Conditions:
- Blue Ice

