ADARB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16748
Additional Names:: ADAR2|ADARB1|DRABA2|DRADA2|NEDHYMS|RED1
Application:: ELISA, WB
Molecular Weight:: 81kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: FETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCING
Uniprot:: P78563
Synonyms:: ADAR2;adenosine deaminase, RNA-specific, B1 (homolog of rat RED1);double-stranded RNA-specific editase 1;DRABA2;DRADA2;dsRNA adenosine deaminase;dsRNA adenosine deaminase DRADA2;NEDHYMS;RED1;RNA editing deaminase 1;RNA-editing deaminase 1;RNA-editing enzyme 1
Extra Details:: This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region.