A16721
SATB2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16721
- Additional Names:
- C2DELq32q33|DEL2Q32Q33|GLSS|SATB2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 83kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR
- Uniprot:
- Q9UPW6
- Synonyms:
- DNA-binding protein SATB2;GLSS;SATB family member 2;special AT-rich sequence-binding protein 2
- Extra Details:
- This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.
- Shipping Conditions:
- Blue Ice