A1672
CDC25C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1672
- Additional Names:
- CDC25|CDC25C|PPP1R60
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
- Uniprot:
- P30307
- Synonyms:
- CDC25;CDC25 homolog C;dual specificity phosphatase CDC25C;M-phase inducer phosphatase 3;mitosis inducer CDC25;phosphotyrosine phosphatase;PPP1R60;protein phosphatase 1, regulatory subunit 60
- Extra Details:
- This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described.
- Shipping Conditions:
- Blue Ice