A1671
CCL4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1671
- Additional Names:
- ACT2|AT744.1|CCL4|G-26|HC21|LAG-1|LAG1|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 12 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
- Uniprot:
- P13236
- Synonyms:
- ACT2;AT744.1;AT744.2;C-C motif chemokine 4;C-C motif chemokine 4-like;CC chemokine ligand 4L1;CCL4L;chemokine (C-C motif) ligand 4;chemokine (C-C motif) ligand 4-like 1, telomeric;G-26;G-26 T-lymphocyte-secreted protein;HC21;LAG-1;LAG1;lymphocyte activation gene 1 protein;macrophage inflammatory protein 1-beta;macrophage inflammatory protein-1b2;MIP-1-beta;MIP-1-beta(1-69);MIP1B;MIP1B1;Monocyte adherence-induced protein 5-alpha;PAT 744;Protein H400;SCYA2;SCYA4;SCYA4L;SCYA4L1;SCYA4L2;secreted protein G-26;SIS-gamma;small inducible cytokine A4 (homologous to mouse Mip-1b);small inducible cytokine A4-like;Small-inducible cytokine A4;Small-inducible cytokine A4-like;T-cell activation protein 2
- Extra Details:
- The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions.
- Shipping Conditions:
- Blue Ice



