A16689
CDKL3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16689
- Additional Names:
- CDKL3|NKIAMRE
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 52kDa/72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN
- Uniprot:
- Q8IVW4
- Synonyms:
- cyclin-dependent kinase-like 3;NKIAMRE;serine-threonine protein kinase NKIAMRE;Serine/threonine-protein kinase NKIAMRE
- Extra Details:
- The protein encoded by this gene is a member of cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This gene was identified as a gene absent in leukemic patients with chromosome 5q deletion. This loss may be an important determinant of dysmyelopoiesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice