A16682
LSM14A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16682
- Additional Names:
- C19orf13|FAM61A|LSM14A|RAP55|RAP55A
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS
- Uniprot:
- Q8ND56
- Synonyms:
- alphaSNBP;C19orf13;FAM61A;family with sequence similarity 61, member A;hRAP55;hRAP55A;LSM14 homolog A;LSM14A, SCD6 homolog A;Protein FAM61A;protein LSM14 homolog A;protein SCD6 homolog;putative alpha-synuclein-binding protein;RAP55;RAP55A;RNA-associated protein 55;RNA-associated protein 55A
- Extra Details:
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Shipping Conditions:
- Blue Ice



