A1668
CHGA Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1668
- Additional Names:
- CGA|CHGA|PHE5|PHES
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARA
- Uniprot:
- P10645
- Synonyms:
- betagranin (N-terminal fragment of chromogranin A);catestatin;CGA;chromofungin;chromogranin-A;parathyroid secretory protein 1;pituitary secretory protein I;SP-I
- Extra Details:
- The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

