USP21 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16663
Additional Names:: USP16|USP21|USP23
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 63kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPDERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVAL
Uniprot:: Q9UK80
Synonyms:: deubiquitinating enzyme 21;NEDD8-specific protease;ubiquitin carboxyl-terminal hydrolase 21;ubiquitin specific protease 21;ubiquitin thioesterase 21;ubiquitin thiolesterase 21;ubiquitin-specific processing protease 21;ubiquitin-specific protease 16;Ubiquitin-specific-processing protease 21;USP16;USP23
Extra Details:: This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.