Epn2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16623
Additional Names:: 9530051D10Rik|Epn2|Ibp2
Application:: ELISA, WB
Molecular Weight:: 68kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
Uniprot:: O95208
Synonyms:: 9530051D10Rik;AA536924;EHB21;EPS-15-interacting protein 2;Eps15 binding protein;epsin-2;Ib;Ibp2;intersectin-EH-binding protein 2
Extra Details:: Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway; embryonic organ development; and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).