NPSR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16618
Additional Names:: ASRT2|GPR154|GPRA|NPSR|NPSR1|PGR14|VRR1
Application:: ELISA, WB
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI
Uniprot:: Q6W5P4
Synonyms:: ASRT2;G-protein coupled receptor 154;G-protein coupled receptor for asthma susceptibility;G-protein coupled receptor PGR14;GPR154;GPRA;neuropeptide S receptor;NPSR;PGR14;vasopressin receptor-related receptor 1;VRR1
Extra Details:: This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.