SPC24 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16601
Additional Names:: SPBC24|SPC24
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW
Uniprot:: Q8NBT2
Synonyms:: hSpc24;kinetochore protein Spc24;SPBC24;SPC24, NDC80 kinetochore complex component, homolog;spindle pole body component 24 homolog
Extra Details:: Predicted to be involved in cell division. Located in nucleolus and nucleoplasm. Part of Ndc80 complex.