A16597
SOGA1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16597
- Additional Names:
- C20orf117|KIAA0889|SOGA|SOGA1
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
- Uniprot:
- O94964
- Synonyms:
- C20orf117;KIAA0889;protein SOGA1;SOGA;SOGA family member 1;suppressor of glucose by autophagy;suppressor of glucose from autophagy;suppressor of glucose, autophagy-associated protein 1
- Extra Details:
- Predicted to be involved in insulin receptor signaling pathway; negative regulation of gluconeogenesis; and regulation of autophagy. Located in extracellular space.
- Shipping Conditions:
- Blue Ice