A16594
NRN1L Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16594
- Additional Names:
- cpg15-2|MRCC2446|NRN1L|UNQ2446
- Application:
- ELISA, WB
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
- Uniprot:
- Q496H8
- Synonyms:
- cpg15-2;MRCC2446;neuritin-like protein;UNQ2446
- Extra Details:
- The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer.
- Shipping Conditions:
- Blue Ice