A16587
ARHGAP11B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16587
- Additional Names:
- ARHGAP11B|B'-T|FAM7B1|GAP (1-8)
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
- Uniprot:
- Q3KRB8
- Synonyms:
- B'-T;FAM7B1;family with sequence similarity 7, member B1;GAP (1-8);inactive Rho GTPase-activating protein 11B;Protein FAM7B1;rho GTPase-activating protein 11B;rho-type GTPase-activating protein 11B
- Extra Details:
- Predicted to enable GTPase activator activity. Involved in cerebral cortex development and negative regulation of mitochondrial membrane permeability. Acts upstream of with a positive effect on glutamine catabolic process. Located in mitochondrial matrix.
- Shipping Conditions:
- Blue Ice