PTPN5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16585
Additional Names:: PTPN5|PTPSTEP|STEP|STEP61
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 46kDa/61kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEI
Uniprot:: P54829
Synonyms:: neural-specific protein-tyrosine phosphatase;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);protein-tyrosine phosphatase striatum-enriched;PTPSTEP;STEP;STEP61;striatal-enriched protein tyrosine phosphatase;striatum-enriched protein-tyrosine phosphatase;tyrosine-protein phosphatase non-receptor type 5
Extra Details:: Enables phosphotyrosine residue binding activity. Predicted to be involved in peptidyl-tyrosine dephosphorylation. Predicted to act upstream of or within protein dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be integral component of membrane. Biomarker of Alzheimer's disease.