A16583
ZGPAT Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16583
- Additional Names:
- GPATC6|GPATCH6|KIAA1847|ZC3H9|ZC3HDC9|ZGPAT|ZIP
- Application:
- ELISA, WB
- Molecular Weight:
- 57kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTE
- Uniprot:
- Q8N5A5
- Synonyms:
- g patch domain-containing protein 6;GPATC6;GPATCH6;KIAA1847;ZC3H9;ZC3HDC9;zinc finger and G patch domain-containing protein;zinc finger CCCH domain-containing protein 9;zinc finger CCCH-type with G patch domain-containing protein;zinc finger, CCCH-type with G patch domain;ZIP
- Extra Details:
- Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of epidermal growth factor-activated receptor activity and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm and plasma membrane.
- Shipping Conditions:
- Blue Ice