A1658
Carbonic Anhydrase 9 (CA9/G250) Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1658
- Additional Names:
- CAIX|Carbonic Anhydrase 9 (CA9/G250)|MN
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
- Uniprot:
- Q16790
- Synonyms:
- CA-IX;CAIX;carbonate dehydratase IX;carbonic anhydrase 9;carbonic anhydrase IX;carbonic dehydratase;membrane antigen MN;MN;P54/58N;pMW1;RCC-associated antigen G250;RCC-associated protein G250;renal cell carcinoma-associated antigen G250
- Extra Details:
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.
- Shipping Conditions:
- Blue Ice