A16573
HKDC1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16573
- Additional Names:
- HKDC1|RP92
- Application:
- ELISA, WB
- Molecular Weight:
- 120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG
- Uniprot:
- Q2TB90
- Synonyms:
- hexokinase domain-containing protein 1;hexokinase HKDC1;putative hexokinase HKDC1
- Extra Details:
- This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma.
- Shipping Conditions:
- Blue Ice