ACBD3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16568
Additional Names:: ACBD3|GCP60|GOCAP1|GOLPH1|PAP7
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVE
Uniprot:: Q9H3P7
Synonyms:: Acyl-CoA-binding domain-containing protein 3;acyl-Coenzyme A binding domain containing 3;GCP60;GOCAP1;golgi complex associated protein 1, 60kDa;Golgi complex-associated protein 1;golgi phosphoprotein 1;Golgi resident protein GCP60;GOLPH1;PAP7;PBR- and PKA-associated protein 7;peripheral benzodiazepine receptor-associated protein PAP7;PKA (RIalpha)-associated protein
Extra Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.