A16567
ELOVL5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16567
- Additional Names:
- dJ483K16.1|ELOVL5|HELO1|SCA38
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
- Uniprot:
- Q9NYP7
- Synonyms:
- 3-keto acyl-CoA synthase ELOVL5;dJ483K16.1;elongation of very long chain fatty acids protein 5;ELOVL FA elongase 5;ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast);ELOVL fatty acid elongase 5;fatty acid elongase 1;HELO1;homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2;SCA38;spinocerebellar ataxia 38;very long chain 3-ketoacyl-CoA synthase 5;very long chain 3-oxoacyl-CoA synthase 5
- Extra Details:
- This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene.
- Shipping Conditions:
- Blue Ice