A16555
PMEPA1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16555
- Additional Names:
- PMEPA1|STAG1|TMEPAI
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
- Uniprot:
- Q969W9
- Synonyms:
- Prostate transmembrane protein androgen induced 1;protein TMEPAI;solid tumor-associated 1 protein;STAG1;TMEPAI;Transmembrane prostate androgen-induced protein;transmembrane, prostate androgen induced RNA
- Extra Details:
- This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice