A16517
P2RY10 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16517
- Additional Names:
- LPS2|LYPSR2|P2RY10|P2Y10
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
- Uniprot:
- O00398
- Synonyms:
- G-protein coupled purinergic receptor P2Y10;LYPSR2;P2Y-like receptor;P2Y10;purinergic receptor P2Y, G-protein coupled, 10;purinergic receptor P2Y10;putative P2Y purinoceptor 10
- Extra Details:
- The protein encoded by this gene belongs to the family of G-protein coupled receptors that are preferentially activated by adenosine and uridine nucleotides. There is a pseudogene for this gene nearby on chromosome X. Multiple alternatively spliced transcripts have been observed.
- Shipping Conditions:
- Blue Ice