A16509
RAB26 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16509
- Additional Names:
- RAB26|V46133
- Application:
- ELISA, WB
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
- Uniprot:
- Q9ULW5
- Synonyms:
- Ras-related oncogene protein;ras-related protein Rab-26;V46133
- Extra Details:
- Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).
- Shipping Conditions:
- Blue Ice

