PPFIBP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16456
Additional Names:: hSGT2|hSgt2p|L2|NEDSMBA|PPFIBP1|SGT2
Application:: ELISA, WB
Molecular Weight:: 114kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNFGNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSNV
Uniprot:: Q86W92
Synonyms:: hSGT2;hSgt2p;L2;liprin related protein;liprin-beta-1;Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1;protein-tyrosine phosphatase receptor-type f polypeptide-interacting protein-binding protein 1;PTPRF interacting protein, binding protein 1 (liprin beta 1);PTPRF-interacting protein-binding protein 1;SGT2
Extra Details:: The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Shipping Conditions:: Blue Ice