UBE2E2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16441
Additional Names:: UBCH8|UBE2E2
Application:: ELISA, WB
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Uniprot:: Q96LR5
Synonyms:: E2 ubiquitin-conjugating enzyme E2;UBCH8;ubiquitin carrier protein E2;ubiquitin conjugating enzyme E2E 2;ubiquitin-conjugating enzyme E2 E2;ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5);ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast);ubiquitin-protein ligase E2
Extra Details:: Enables ISG15 transferase activity and ubiquitin conjugating enzyme activity. Involved in protein modification by small protein conjugation. Acts upstream of or within cellular response to DNA damage stimulus and positive regulation of G1/S transition of mitotic cell cycle. Predicted to be active in nucleus.