SUPT6H Rabbit polyclonal antibody

Size

£152.00

SKU:: A16434
Additional Names:: emb-5|SPT6|SPT6H|SUPT6H
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 260kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Uniprot:: Q7KZ85
Synonyms:: emb-5;histone chaperone suppressor of Ty6;SPT6;SPT6H;suppressor of Ty 6 homolog;tat-cotransactivator 2 protein;tat-CT2 protein;transcription elongation factor SPT6
Extra Details:: Enables histone binding activity. Involved in negative regulation of histone H3-K27 methylation and positive regulation of transcription elongation from RNA polymerase II promoter. Predicted to be located in nucleoplasm. Predicted to be part of transcription elongation factor complex. Predicted to be active in transcriptionally active chromatin.