A16386
CXCR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16386
- Additional Names:
- C-C|C-C-CKR-1|CD128|CD181|CDw128a|CKR-1|CMKAR1|CXCR1|IL8R1|IL8RA|IL8RBA
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
- Uniprot:
- P25024
- Synonyms:
- C-C;C-C-CKR-1;C-X-C chemokine receptor type 1;CD128;CD181;CDw128a;chemokine (C-X-C motif) receptor 1;CKR-1;CMKAR1;CXC-R1;CXCR-1;high affinity interleukin-8 receptor A;IL-8 receptor type 1;IL-8R A;IL8R1;IL8RA;IL8RBA;interleukin 8 receptor, alpha;interleukin-8 receptor type 1;interleukin-8 receptor type A
- Extra Details:
- The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36.
- Shipping Conditions:
- Blue Ice