FGD1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16374
Additional Names:: AAS|FGD1|FGDY|MRXS16|ZFYVE3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS
Uniprot:: P98174
Synonyms:: AAS;faciogenital dysplasia 1 protein;FGDY;FYVE, RhoGEF and PH domain-containing protein 1;MRXS16;rho/Rac GEF;rho/Rac guanine nucleotide exchange factor FGD1;ZFYVE3;zinc finger FYVE domain-containing protein 3
Extra Details:: This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of the faciogenital dysplasia in Aarskog-Scott syndrome and a syndromatic form of X-linked cognitive disability.