A16362
Slc31a2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16362
- Additional Names:
- CTR2|Slc31a2
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
- Uniprot:
- O15432
- Synonyms:
- AI604396;copper transporter 2;COPT2;Ctr;CTR2;hCTR2;probable low affinity copper uptake protein 2;solute carrier family 31 (copper transporter), member 2;solute carrier family 31 (copper transporters), member 2;Solute carrier family 31 member 2
- Extra Details:
- Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome; membrane; and recycling endosome. Is expressed in brain; retina nuclear layer; and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).
- Shipping Conditions:
- Blue Ice