A16355
MYRF Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16355
- Additional Names:
- 11orf9|C11orf9|CUGS|MMERV|MRF|MYRF|Ndt80|pqn-47
- Application:
- ELISA, WB
- Molecular Weight:
- 124kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- ABP:
- No Import Docs
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLN
- Uniprot:
- Q9Y2G1
- Synonyms:
- 11orf9;C11orf9;CUGS;MMERV;MRF;myelin gene regulatory factor;myelin regulatory factor;Ndt80;pqn-47
- Extra Details:
- This gene encodes a transcription factor that is required for central nervous system myelination and may regulate oligodendrocyte differentiation. It is thought to act by increasing the expression of genes that effect myelin production but may also directly promote myelin gene expression. Loss of a similar gene in mouse models results in severe demyelination. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

