A16350
ATP6V0C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16350
- Additional Names:
- ATP6C|ATP6L|ATP6V0C|ATPL|VATL|Vma3|VPPC
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 16 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG
- Uniprot:
- P27449
- Synonyms:
- ATP6C;ATP6L;ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c;ATPL;H(+)-transporting two-sector ATPase, 16 kDa subunit;V-ATPase 16 kDa proteolipid subunit;V-type proton ATPase 16 kDa proteolipid subunit;vacuolar ATP synthase 16 kDa proteolipid subunit;vacuolar H+ ATPase proton channel subunit;vacuolar proton pump 16 kDa proteolipid subunit;VATL;Vma3;VPPC
- Extra Details:
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17.
- Shipping Conditions:
- Blue Ice