A1635
HMGA1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1635
- Additional Names:
- HMG-R|HMGA1|HMGA1A|HMGIY
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 18 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
- Uniprot:
- P17096
- Synonyms:
- High mobility group AT-hook protein 1;high mobility group protein A1;high mobility group protein HMG-I/HMG-Y;high mobility group protein R;HMG-R;HMGA1A;HMGIY;nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y
- Extra Details:
- This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes.
- Shipping Conditions:
- Blue Ice





