ARAF Rabbit polyclonal antibody

Size

£152.00

SKU:: A16346
Additional Names:: A-RAF|ARAF|ARAF1|PKS2|RAFA1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP
Uniprot:: P10398
Synonyms:: A-RAF;A-Raf proto-oncogene serine/threonine-protein kinase;ARAF1;Oncogene ARAF1;PKS2;Proto-oncogene A-Raf;proto-oncogene A-Raf-1;proto-oncogene Pks;RAFA1;Ras-binding protein DA-Raf;serine/threonine-protein kinase A-Raf;v-raf murine sarcoma 3611 viral oncogene homolog 1;v-raf murine sarcoma 3611 viral oncogene-like protein
Extra Details:: Enables protein serine/threonine kinase activity. Involved in negative regulation of apoptotic process; regulation of TOR signaling; and regulation of cellular protein metabolic process. Predicted to be active in cytosol and mitochondrion. Biomarker of high grade glioma.