DUSP15 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16322
Additional Names:: C20orf57|DUSP15|VHY
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 32kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFA
Uniprot:: Q9H1R2
Synonyms:: C20orf57;dual specificity phosphatase-like 15;dual specificity protein phosphatase 15;vaccinia virus VH1-related dual-specific protein phosphatase Y;VH1-related member Y;VHY
Extra Details:: The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants.