FUNDC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16318
Additional Names:: FUNDC1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 17 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Uniprot:: Q8IVP5
Synonyms:: FUN14 domain-containing protein 1
Extra Details:: This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known.