A16307
USP9X Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16307
- Additional Names:
- DFFRX|FAF|FAM|hFAM|MRX99|MRXS99F|USP9X|XLID99
- Application:
- ELISA, WB
- Molecular Weight:
- 292kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA
- Uniprot:
- Q93008
- Synonyms:
- deubiquitinating enzyme FAF-X;DFFRX;Drosophila fat facets related, X-linked;FAF;FAM;fat facets in mammals;fat facets protein related, X-linked;Fat facets protein-related, X-linked;hFAM;MRX99;MRXS99F;probable ubiquitin carboxyl-terminal hydrolase FAF-X;ubiquitin specific protease 9, X chromosome (fat facets-like Drosophila);ubiquitin thioesterase FAF-X;ubiquitin thiolesterase FAF-X;ubiquitin-specific processing protease FAF-X;ubiquitin-specific protease 9, X chromosome;Ubiquitin-specific-processing protease FAF-X;XLID99
- Extra Details:
- This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Shipping Conditions:
- Blue Ice

