A16304
AP1B1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16304
- Additional Names:
- ADTB1|AP105A|AP1B1|BAM22|CLAPB2|KIDAR
- Application:
- ELISA, WB
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- SDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTV
- Uniprot:
- Q10567
- Synonyms:
- adapter-related protein complex 1 subunit beta-1;adaptor protein complex AP-1 subunit beta-1;adaptor related protein complex 1 beta 1 subunit;Adaptor-related protein complex 1 subunit beta-1;ADTB1;ADTB1, CLAPB2;AP-1 complex subunit beta-1;AP105A;BAM22;beta-1-adaptin;beta-adaptin 1;beta-prime-adaptin;beta1-adaptin;CLAPB2;clathrin assembly protein complex 1 beta large chain;Golgi adaptor HA1/AP1 adaptin beta subunit;KIDAR;plasma membrane adaptor HA2/AP2 adaptor beta subunit
- Extra Details:
- Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

