A1630
[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody

Size
POA
- SKU:
- A1630
- Additional Names:
- E)|INSULYSIN
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 118kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYS
- Uniprot:
- P14735
- Synonyms:
- Abeta-degrading protease;insulin protease;insulin-degrading enzyme;insulinase;INSULYSIN
- Extra Details:
- This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.
- Shipping Conditions:
- Blue Ice
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_1.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_2.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_3.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_4.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_H985_WB_01.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_H985_KO-WB_01.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_N34055-4_IHC_01.jpg)
![[KO Validated] Insulin-degrading enzyme (IDE) Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1630/A1630_H985_IF_01.jpg)