A16297
USP22 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16297
- Additional Names:
- USP22|USP3L
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEP
- Uniprot:
- Q9UPT9
- Synonyms:
- deubiquitinating enzyme 22;ubiquitin carboxyl-terminal hydrolase 22;ubiquitin specific protease 22;ubiquitin thioesterase 22;ubiquitin thiolesterase 22;ubiquitin-specific processing protease 22;Ubiquitin-specific-processing protease 22;USP3L
- Extra Details:
- Enables enzyme binding activity; nuclear receptor coactivator activity; and thiol-dependent deubiquitinase. Contributes to H4 histone acetyltransferase activity. Involved in positive regulation of mitotic cell cycle; positive regulation of transcription, DNA-templated; and protein modification by small protein conjugation or removal. Part of SAGA complex.
- Shipping Conditions:
- Blue Ice

