A16296
SRA1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16296
- Additional Names:
- pp7684|SRA|SRA1|SRAP|STRAA1
- Application:
- ELISA, WB
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
- Uniprot:
- Q9HD15
- Synonyms:
- pp7684;SRA;SRAP;steroid receptor coactivator;steroid receptor RNA activator 1;steroid receptor RNA activator 1 (complexes with NCOA1);steroid receptor RNA activator protein;STRAA1
- Extra Details:
- Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.
- Shipping Conditions:
- Blue Ice