[KD Validated] CDX2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1629
Additional Names:: CDX-3|CDX2|CDX2/AS|CDX3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 36 kDa/38 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNL
Uniprot:: Q99626
Synonyms:: caudal type homeobox transcription factor 2;caudal-type homeobox protein 2;CDX-3;CDX2/AS;CDX3;homeobox protein CDX-2;homeobox protein miniCDX2
Extra Details:: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.