VHL Rabbit polyclonal antibody

Size

£152.00

SKU:: A16287
Additional Names:: HRCA1|pVHL|RCA1|VHL|VHL1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 24kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT
Uniprot:: P40337
Synonyms:: elongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase
Extra Details:: This gene encodes a component of a ubiquitination complex. The encoded protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. In addition to oxygen-related gene expression, this protein plays a role in many other cellular processes including cilia formation, cytokine signaling, regulation of senescence, and formation of the extracellular matrix. Variants of this gene are associated with von Hippel-Lindau syndrome, pheochromocytoma, erythrocytosis, renal cell carcinoma, and cerebellar hemangioblastoma.