A16274
WASF3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16274
- Additional Names:
- Brush-1|SCAR3|WASF3|WAVE3
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
- Uniprot:
- Q9UPY6
- Synonyms:
- Brush-1;protein WAVE-3;SCAR3;verprolin homology domain-containing protein 3;WAS protein family member 3;WASP family Verprolin-homologous protein 3;WAVE3;wiskott-Aldrich syndrome protein family member 3
- Extra Details:
- This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants
- Shipping Conditions:
- Blue Ice