A16249
LATS2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16249
- Additional Names:
- KPM|LATS2
- Application:
- ELISA, WB
- Molecular Weight:
- 150 kDa(N terminal protein)
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPR
- Uniprot:
- Q9NRM7
- Synonyms:
- kinase phosphorylated during mitosis protein;KPM;large tumor suppressor homolog 2;LATS (large tumor suppressor, Drosophila) homolog 2;LATS, large tumor suppressor, homolog 2;serine/threonine kinase KPM;serine/threonine-protein kinase kpm;serine/threonine-protein kinase LATS2;warts-like kinase
- Extra Details:
- This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.
- Shipping Conditions:
- Blue Ice

