MAP3K11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16242
Additional Names:: MAP3K11|MEKK11|MLK-3|MLK3|PTK1|SPRK
Application:: ELISA, WB
Molecular Weight:: 93kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: LVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEH
Uniprot:: Q16584
Synonyms:: MEKK11;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 3;MLK-3;MLK3;protein-tyrosine kinase PTK1;PTK1;SH3 domain-containing proline-rich kinase;SPRK;src-homology 3 domain-containing proline-rich kinase
Extra Details:: The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42.