[KO Validated] KMT5C Rabbit polyclonal antibody

Size

POA

SKU:: A16235
Additional Names:: 5C|Suv4-20h2|SUV420H2
Application:: ELISA, WB
Molecular Weight:: 52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
Uniprot:: Q86Y97
Synonyms:: [histone H4]-lysine20 N-methyltransferase KMT5B;[histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B;histone-lysine N-methyltransferase KMT5C;histone-lysine N-methyltransferase SUV420H2;lysine (K)-specific methyltransferase 5C;lysine N-methyltransferase 5C;lysine-specific methyltransferase 5C;su(var)4-20 homolog 2;suppressor of variegation 4-20 homolog 2;Suv4-20h2;SUV420H2
Extra Details:: SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).