A16233
GGPS1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16233
- Additional Names:
- GGPPS|GGPPS1|GGPS1|MDHLO|MUDHLOV
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
- Uniprot:
- O95749
- Synonyms:
- (2E,6E)-farnesyl diphosphate synthase;dimethylallyltranstransferase;farnesyl diphosphate synthase;farnesyltranstransferase;Geranylgeranyl diphosphate synthase;geranylgeranyl pyrophosphate synthase;geranyltranstransferase;GGPP synthase;GGPPS;GGPPS1;GGPPSase;MDHLO;MUDHLOV
- Extra Details:
- This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene.
- Shipping Conditions:
- Blue Ice