A16214
GSPT1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16214
- Additional Names:
- 551G9.2|eRF3a|ETF3A|GSPT1|GST1
- Application:
- ELISA, WB
- Molecular Weight:
- 80 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- SMELSEPIENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLP
- Uniprot:
- P15170
- Synonyms:
- 551G9.2;eRF3a;ETF3A;eukaryotic peptide chain release factor GTP-binding subunit ERF3A;eukaryotic peptide chain release factor subunit 3a;eukaryotic release factor 3a;G1 to S phase transition protein 1 homolog;GST1
- Extra Details:
- Enables translation release factor activity. Involved in regulation of translational termination. Acts upstream of or within protein methylation. Predicted to be located in cytosol. Predicted to be part of translation release factor complex.
- Shipping Conditions:
- Blue Ice