A1621
FABPI Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1621
- Additional Names:
- FABPI|I-FABP
- Application:
- ELISA, WB
- Molecular Weight:
- 15kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
- Uniprot:
- P12104
- Synonyms:
- FABPI;fatty acid binding protein 2, intestinal;Fatty acid-binding protein 2;fatty acid-binding protein, intestinal;I-FABP;intestinal-type fatty acid-binding protein
- Extra Details:
- The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
- Shipping Conditions:
- Blue Ice

